PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34310.1
Common NameARF12, F23M19.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 593aa    MW: 67217.7 Da    PI: 6.6985
Description auxin response factor 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34310.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.4e-23126227199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f kvlt sd++++g + +pkk+a e+     ++++   ++l   d++g++W+++++yr++++r++lt+GW+ F  +++L +gD++vF   + +++el+
  AT1G34310.1 126 FTKVLTASDTSAHGGFFVPKKHAIEClpsldMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFV--RGETGELR 221
                  89****************************9666666779************************************************..449999** PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  v+++r+
  AT1G34310.1 222 VGIRRA 227
                  ****97 PP

2Auxin_resp96.34.4e-32252331183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a ha++++++F+vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf m++e++d+serr+ Gt++gvsd++p +W+ S+WrsL+
  AT1G34310.1 252 AKHAFDNQCMFTVVYKPRS--SKFIVSYDKFLDAVNNKFNVGSRFTMRLEGDDFSERRCFGTIIGVSDFSP-HWKCSEWRSLE 331
                  6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.9E-37116238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-31123247IPR015300DNA-binding pseudobarrel domain
CDDcd100172.10E-20125226No hitNo description
PfamPF023623.4E-20126227IPR003340B3 DNA binding domain
PROSITE profilePS5086313.296126228IPR003340B3 DNA binding domain
SMARTSM010198.8E-22126228IPR003340B3 DNA binding domain
PfamPF065073.7E-28252330IPR010525Auxin response factor
PfamPF023098.6E-7503547IPR033389AUX/IAA domain
SuperFamilySSF542775.98E-11509588No hitNo description
PROSITE profilePS5174526.629511592IPR000270PB1 domain
PfamPF023095.1E-5555591IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MESGNVVNAQ PELSGIIDGS KSYVYEQLWK LCAGPLCDIP KLGEKVYYFP QGHIELVETS  60
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDETYAEI TLMPDTTQVV IPTQNENQFR  120
PLVNSFTKVL TASDTSAHGG FFVPKKHAIE CLPSLDMSQP LPAQELLAID LHGNQWRFNH  180
NYRGTPQRHL LTTGWNAFTT SKKLVAGDVI VFVRGETGEL RVGIRRARHQ QGNIPSSIVS  240
IDCMRHGVVA SAKHAFDNQC MFTVVYKPRS SKFIVSYDKF LDAVNNKFNV GSRFTMRLEG  300
DDFSERRCFG TIIGVSDFSP HWKCSEWRSL EVQWDEFTSF PGPKKVSPWD IEHLMPAINV  360
PRSFLLKNKR LREVNEIGSS SSHLLPPILT QGQENEQLSV ASPMNISLRY RDATEDAMNP  420
SKLLMSYPVQ PMPKLNYNNQ MVTEMEENIT TKTGTNFRLF GVTLDTPPVI KDPIEEIGSE  480
ISKLTEGKKF GLSQTLRSPT EIQNKQFSSS RTCTKVQMQG VTIGRAVDLS VLNGYDQLIL  540
ELEKLFDIKG QLQTRNQWEI AFTDSDEDKM LVGDDPWPEF CNMVKKIFIQ KRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1162735422355Auxin response factor 1
4ldw_A1e-1162735422355Auxin response factor 1
4ldw_B1e-1162735422355Auxin response factor 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425625150.0
Genevisible262566_at0.0
Expression AtlasAT1G34310-
AtGenExpressAT1G34310-
ATTED-IIAT1G34310-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G34390, AT1G59750
IntActSearch Q9XID4
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697920.0AY669792.1 Arabidopsis thaliana clone C105347 ARF12 (At1g34310) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174691.20.0auxin response factor 12
SwissprotQ9XID40.0ARFL_ARATH; Auxin response factor 12
TrEMBLC0SUZ10.0C0SUZ1_ARATH; Auxin response factor (Fragment)
STRINGAT1G34310.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Representative plantOGRP5261578
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  3. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  4. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  5. Andreasson E, et al.
    The MAP kinase substrate MKS1 is a regulator of plant defense responses.
    EMBO J., 2005. 24(14): p. 2579-89
    [PMID:15990873]
  6. Axtell MJ,Snyder JA,Bartel DP
    Common functions for diverse small RNAs of land plants.
    Plant Cell, 2007. 19(6): p. 1750-69
    [PMID:17601824]
  7. Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
    Cell-specific nitrogen responses mediate developmental plasticity.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8
    [PMID:18180456]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  10. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  11. Varaud E, et al.
    AUXIN RESPONSE FACTOR8 regulates Arabidopsis petal growth by interacting with the bHLH transcription factor BIGPETALp.
    Plant Cell, 2011. 23(3): p. 973-83
    [PMID:21421811]
  12. Vernoux T, et al.
    The auxin signalling network translates dynamic input into robust patterning at the shoot apex.
    Mol. Syst. Biol., 2011. 7: p. 508
    [PMID:21734647]
  13. Li JF,Bush J,Xiong Y,Li L,McCormack M
    Large-scale protein-protein interaction analysis in Arabidopsis mesophyll protoplasts by split firefly luciferase complementation.
    PLoS ONE, 2011. 6(11): p. e27364
    [PMID:22096563]